AADACL1 Antibody Summary
| Immunogen |
Synthetic peptide directed towards the middle region of human Aadacl1The immunogen for this antibody is Aadacl1. Peptide sequence LQALDFNTPSYQQSMNTPILPRHVMVRYWLDYFKGNYDFVEAMIVNNHTS.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
NCEH1
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against Aadacl1 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for AADACL1 Antibody
- AADACL1
- EC 3.1.1.79
- KIAA1363EC 3.1.1
- NCEHArylacetamide deacetylase-like 1EC 3.1.1.-
- neutral cholesterol ester hydrolase 1