AASDH Antibody Summary
| Immunogen |
Synthetic peptides corresponding to AASDH(aminoadipate-semialdehyde dehydrogenase) The peptide sequence was selected from the middle region of AASDH.Peptide sequence TDGKVWILESQSGQLQSVYELPGEVFSSPVVLESMLIIGCRDNYVYCLDL.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
AASDH
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against AASDH and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for AASDH Antibody
- ACSF4acyl-CoA synthetase family member 4
- aminoadipate-semialdehyde dehydrogenase
- EC 6.2.1.-
- LYS2
- non-ribosomal peptide synthetase 1098
- non-ribosomal peptide synthetase 998,2-aminoadipic 6-semialdehyde dehydrogenase
- NRPS1098
- NRPS998
- Protein NRPS998
- U26
Background
Acyl-CoA synthases catalyze the initial reaction in fatty acid metabolism, by forming a thioester with CoA.