AGO1/EIF2C1 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to EIF2C1(eukaryotic translation initiation factor 2C, 1) The peptide sequence was selected from the N terminal of EIF2C1.Peptide sequence MEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKI.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
EIF2C1
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against EIF2C1 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for AGO1/EIF2C1 Antibody
- AGO1Q99
- argonaute 1
- argonaute1
- DKFZp686M13167
- eIF2C 1
- eIF-2C 1
- EIF2C
- Eukaryotic translation initiation factor 2C 1
- eukaryotic translation initiation factor 2C, 1
- GERP95
- Golgi Endoplasmic Reticulum protein 95 kDa
- hAgo1
- protein argonaute-1
- Putative RNA-binding protein Q99
Background
This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-me