AGPAT2 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to AGPAT2(1-acylglycerol-3-phosphate O-acyltransferase 2 ) The peptide sequence was selected from the C terminal of AGPAT2.Peptide sequence LEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSGVQPA.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
AGPAT2
|
| Purity |
Protein A purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against AGPAT2 and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Theoretical MW |
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Protein A purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for AGPAT2 Antibody
- 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acidacyltransferase, beta)
- 1-acylglycerol-3-phosphate O-acyltransferase 2
- 1-AGPAT 2,1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acidacyltransferase-beta)
- 1-AGPAT2,1-AGP acyltransferase 2,1-acyl-sn-glycerol-3-phosphate acyltransferase beta
- Berardinelli-Seip congenital lipodystrophy
- BSCL
- BSCL1
- EC 2.3.1.51
- LPAAB
- LPAAT-beta
- Lysophosphatidic acid acyltransferase beta
- lysophosphatidic acid acyltransferase-beta
Background
AGPAT2 is a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. The protein is located within the endoplasmic reticulum membrane and converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. Mutations in its gene have been associated with congenital generalized lipodystrophy (CGL), or Berardinelli-Seip syndrome, a disease characterized by a near absence of adipose tissue and severe insulin resistance.This gene encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. The protein is located within the endoplasmic reticulum membrane and converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. Mutations in this gene have been associated with congenital generalized lipodystrophy (CGL), or Berardinelli-Seip syndrome, a disease characterized by a near absence of adipose tissue and severe insulin resistance. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.