ANKMY2 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to ANKMY2(ankyrin repeat and MYND domain containing 2) Antibody(against the N terminal of ANKMY2 (NP_064715).Peptide sequence MVHIKKGELTQEEKELLEVIGKGTVQEAGTLLSSKNVRVNCLDENGMTPL.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
ANKMY2
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against ANKMY2 and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Theoretical MW |
49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for ANKMY2 Antibody
- ankyrin repeat and MYND domain containing 2
- ankyrin repeat and MYND domain-containing protein 2
- DKFZP564O043
- ZMYND20
Background
The function of this protein remains unknown.