AP1M2 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to AP1M2 (adaptor-related protein complex 1, mu 2 subunit) The peptide sequence was selected from the N terminal of AP1M2 (NP_005489).Peptide sequence:MSASAVFILDVKGKPLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLL.
|
| Specificity |
This product is specific to Subunit or Isofrom: mu-2.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
AP1M2
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against AP1M2 and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Theoretical MW |
48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for AP1M2 Antibody
- Adaptor protein complex AP-1 mu-2 subunit
- Adaptor-related protein complex 1 mu-2 subunit
- adaptor-related protein complex 1, mu 2 subunit
- AP-1 complex subunit mu-2
- AP1-mu2
- AP-mu chain family member mu1B
- Clathrin assembly protein complex 1 medium chain 2
- clathrin coat assembly protein AP47 2
- clathrin coat associated protein AP47 2
- clathrin-associated adaptor medium chain mu2
- golgi adaptor AP-1 47 kDa protein
- Golgi adaptor HA1/AP1 adaptin mu-2 subunit
- HA1 47 kDa subunit 2
- HSMU1B
- MU1B
- MU-1B
- mu1B-adaptin
- mu2
- Mu-adaptin 2
Background
This gene encodes a subunit of the heterotetrameric adaptor-related protein comlex 1 (AP-1), which belongs to the adaptor complexes medium subunits family. This protein is capable of interacting with tyrosine-based sorting signals.