Product: 4-Azido-L-phenylalanine (hydrochloride)
AP3M2 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to AP3M2(adaptor-related protein complex 3, mu 2 subunit) The peptide sequence was selected from the middle region of AP3M2 (NP_006794).Peptide sequence VVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVIEEIDAIID.
|
| Specificity |
This product is specific to Subunit or Isofrom: mu-2.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
AP3M2
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
|
| Application Notes |
This is a rabbit polyclonal antibody against AP3M2 and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Theoretical MW |
47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for AP3M2 Antibody
- Adapter-related protein complex 3 mu-2 subunit
- adaptor-related protein complex 3, mu 2 subunit
- AP-3 complex subunit mu-2
- AP47B
- CLA20
- Clathrin assembly protein assembly protein complex 1 medium chain homolog 2
- Clathrin coat assembly protein AP47 homolog 2
- Clathrin coat-associated protein AP47 homolog 2
- clathrin-associated protein AP47 homolog 2
- Golgi adaptor AP-1 47 kDa protein homolog 2
- HA1 47 kDa subunit homolog 2
- HA1 47kDA subunit homolog 2
- mu3B-adaptin
- P47B
Background
AP3M2 is part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes.This gene encodes a subunit of the heterotetrameric adaptor-related protein comlex 3 (AP-3), which belongs to the adaptor complexes medium subunits family. The AP-3 complex plays a role in protein trafficking to lysosomes and specialized organelles.