AP3S1 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to AP3S1(adaptor-related protein complex 3, sigma 1 subunit) The peptide sequence was selected from the N terminal of AP3S1 (NP_001275).Peptide sequence IKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLE.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
AP3S1
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
|
| Application Notes |
This is a rabbit polyclonal antibody against AP3S1 and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Theoretical MW |
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for AP3S1 Antibody
- Adapter-related protein complex 3 sigma-1 subunit
- adaptor-related protein complex 3, sigma 1 subunit
- AP-3 complex sigma-3A subunit
- AP-3 complex subunit sigma-3A
- CLAPS3AP-3 complex subunit sigma-1
- Clathrin-associated/assembly/adapter protein, small 3
- clathrin-associated/assembly/adaptor protein, small 3 (22kD)
- Sigma3A
- sigma-3A-adaptin
- sigma3A-adaptin
- Sigma-adaptin 3a
Background
AP3S1 is part of the AP-3 complex, an adapter-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes.