Product: Ecteinascidin-Analog-1
APJ/Apelin receptor Antibody Summary
| Immunogen |
The immunogen for this antibody is apelin receptor – C-terminal region. Peptide sequence CCDQSGCKGTPHSSSAEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQ.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
APLNR
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
| Theoretical MW |
42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for APJ/Apelin receptor Antibody
- AGTRL1
- AGTRL1HG11
- angiotensin II receptor-like 1
- Angiotensin receptor-like 1
- apelin receptor
- APJ (apelin) receptor
- APJ receptor
- APJ
- APJFLJ96609
- APJR
- APLNR
- FLJ90771
- G protein-coupled receptor APJ
- G-protein coupled receptor APJ
- G-protein coupled receptor HG11
- HG11 orphan receptor
- HG11
- MGC45246
Background
Aplnr is a receptor for apelin coupled to G proteins that inhibit adenylate cyclase activity.