ATP5F1 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to ATP5F1(ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1) The peptide sequence was selected from the middle region of ATP5F1.Peptide sequence VTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEK
|
| Specificity |
This product is specific to Subunit or Isofrom: b, mitochondrial.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
ATP5F1
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against ATP5F1 and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Theoretical MW |
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for ATP5F1 Antibody
- ATP synthase B chain, mitochondrial
- ATP synthase subunit b, mitochondrial
- ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b
- ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b, isoform 1
- ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1
- ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1
- ATPase subunit b
- cell proliferation-inducing protein 47
- H+-ATP synthase subunit b
- MGC24431
- PIG47
Background
ATP5F1 is a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the b subunit of the proton channel.This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the b subunit of the proton channel.