Ankyrin 1 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to ANK1(ankyrin 1, erythrocytic) The peptide sequence was selected from the middle region of ANK1 (NP_065210).Peptide sequence PCAMPETVVIRSEEQEQASKEYDEDSLIPSSPATETSDNISPVASPVHTG.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
ANK1
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against ANK1 and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Theoretical MW |
189 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
From PBS & 2% Sucrose.
|
| Preservative |
No Preservative
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Ankyrin 1 Antibody
- ANK
- ANK-1
- ankyrin 1, erythrocytic
- ankyrin-1
- ankyrin-R
- Erythrocyte ankyrin
- SPH1
- SPH2
Background
Ankyrins are a family of proteins that are believed to link the integral membrane proteins to the underlying spectrin-actin cytoskeleton and play key roles in activities such as cell motility, activation, proliferation, contact and the maintenance of spec