Argonaute 3 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to EIF2C3(eukaryotic translation initiation factor 2C, 3) The peptide sequence was selected from the N terminal of EIF2C3. Peptide sequence MCEVLDIHNIDEQPRPLTDSHRVKFTKEIKGLKVEVTHCGTMRRKYRVCN.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
EIF2C3
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
|
| Application Notes |
This is a rabbit polyclonal antibody against EIF2C3 and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Theoretical MW |
69 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Argonaute 3 Antibody
- AGO3argonaute 3
- argonaute3
- eIF2C 3
- eIF-2C 3
- Eukaryotic translation initiation factor 2C 3
- eukaryotic translation initiation factor 2C, 3
- FLJ12765
- hAgo3
- MGC86946
- protein argonaute-3
Background
EIF2C3 is a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, contains a PAZ domain and a PIWI domain, and may play a role in short-interfering-RNA-mediated gene silencing. This gene is