Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to B3GNT4(UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4) The peptide sequence was selected from the N terminal of B3GNT4. Peptide sequence MLPPQPSAAHQGRGGRSGLLPKGPAMLCRLCWLVSYSLAVLLLGCLLFLR.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
B3GNT4
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against B3GNT4 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
| Theoretical MW |
42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody
- B3GNT4
- B3GN-T4
- beta-1,3-Gn-T4
- Beta-1,3-N-acetylglucosaminyltransferase 4
- beta-1,3-N-acetylglucosaminyltransferase bGn-T4
- beta3Gn-T4
- BGnT-4
- EC 2.4.1.-
- UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4
Background
B3GNT4 is a member of the beta-1,3-N-acetylglucosaminyltransferase protein family. The protein is involved in the biosynthesis of poly-N-acetyllactosamine chains and prefers lacto-N-neotetraose as a substrate. It is a type II transmembrane protein.This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase protein family. The encoded enzyme is involved in the biosynthesis of poly-N-acetyllactosamine chains and prefers lacto-N-neotetraose as a substrate. It is a type II transmembrane protein.