Bradykinin RB2/BDKRB2 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to BDKRB2(bradykinin receptor B2) The peptide sequence was selected from the N terminal of BDKRB2.Peptide sequence MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQV.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
BDKRB2
|
| Purity |
Protein A purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against BDKRB2 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Protein A purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Bradykinin RB2/BDKRB2 Antibody
- B2 bradykinin receptor
- B2R
- BDKRB2
- BK-2 receptor
- BK2
- BK-2
- BKR2
- Bradykinin RB2
- bradykinin receptor B2
- BradykininRB2
- BRB2
- DKFZp686O088
Background
BDKRB2 is a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system.This gene encodes a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system. Alternate start codons result in two isoforms of the protein.