Product: Dabigatran (D4 hydrochloride)
CACNG1 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to Cacng1 (calcium channel, voltage-dependent, gamma subunit 1) The peptide sequence was selected from the N terminal of Cacng1. Peptide sequence AVHNKDKSCEHVTPSGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAI.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
CACNG1
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against Cacng1 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
| Theoretical MW |
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for CACNG1 Antibody
- CACNLGDihydropyridine-sensitive L-type, skeletal muscle calcium channel subunit gamma
- calcium channel, voltage-dependent, gamma subunit 1
- L-type calcium channel gamma polypeptide
- neuronal dihydropyridine-sensitive calcium channel gamma subunit
- voltage-dependent calcium channel gamma-1 subunit
Background
This protein is a subunit of the dihydropyridine (DHP) sensitive calcium channel. Cacng1 plays a role in excitation-contraction coupling. The skeletal muscle DHP-sensitive Ca2+ channel may function only as a multiple subunit complex.