CD77 Synthase Antibody Summary
| Immunogen |
Synthetic peptides corresponding to A4GALT(alpha 1,4-galactosyltransferase (globotriaosylceramide synthase)) The peptide sequence was selected from the middle region of A4GALT (NP_059132). Peptide sequence RIALMWKFGGIYLDTDFIVLKNLRNLTNVLGTQSRYVLNGAFLAF
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
A4GALT
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
|
| Application Notes |
This is a rabbit polyclonal antibody against A4GALT and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
|
| Theoretical MW |
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for CD77 Synthase Antibody
- A14GALTalpha 1,4-galactosyltransferase (globotriaosylceramide synthase, P blood group)
- A4GALT1
- alpha 1,4-galactosyltransferase
- Alpha-1,4-galactosyltransferase
- alpha-1,4-N-acetylglucosaminyltransferase
- alpha4Gal-T1
- CD77 synthase
- EC 2.4.1.228
- Gb3 synthase
- Gb3S
- Globotriaosylceramide synthase
- lactosylceramide 4-alpha-galactosyltransferase
- P blood group (P one antigen)
- P(k) antigen synthase
- P(k)
- P1
- P1/Pk synthase
- PK
- UDP-galactose:beta-D-galactosyl-beta1-R 4-alpha-D-galactosyltransferase
Background
The protein encoded by this gene catalyzes the transfer of galactose to lactosylceramide to form globotriaosylceramide, which has been identified as the P(k) antigen of the P blood group system. The encoded protein, which is a type II membrane protein fou