CHAC2 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to CHAC2(ChaC, cation transport regulator homolog 2 (E. coli)) The peptide sequence was selected from the N terminal of CHAC2.Peptide sequence MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVV.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
CHAC2
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
|
| Application Notes |
This is a rabbit polyclonal antibody against CHAC2 and was validated on Western blot.
|
|
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for CHAC2 Antibody
- cation transport regulator-like protein 2
- ChaC, cation transport regulator homolog 2 (E. coli)
- ChaC, cation transport regulator-like 2 (E. coli)
- ChaC, cation transport regulator-like 2
Background
The specific function of this protein remains unknown.