Product: Cholesterol myristate
CHCHD3 Antibody Summary
| Immunogen |
Peptide with sequence C-RSSEFYRVTTEQYQ corresponding to internal region according to NP_060282.1.
|
| Epitope |
C-RSSEFYRVTTEQYQ
|
| Clonality |
Polyclonal
|
| Host |
Goat
|
| Gene |
CHCHD3
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
- Western Blot 0.3 – 1 ug/ml
- Peptide ELISA Detection limit 1:32000
|
| Application Notes |
WB: Approx. 26.2 kDa band observed in human placenta lysates (calculated MW of 26 kDa band according to NP_060282.1).
|
| Publications |
| Read Publication using NBP1-52009. |
|
Reactivity Notes
Predicted cross-reactivity based on sequence identity: Mouse, Rat, Canine, Bovine, Sheep.
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
0.5 mg/ml Tris (pH 7.3) and 0.5% BSA
|
| Preservative |
0.02% Sodium Azide
|
| Concentration |
0.5 mg/ml
|
| Purity |
Immunogen affinity purified
|
Alternate Names for CHCHD3 Antibody
PMID: 23505009
Product: Nicardipine (Hydrochloride)
CHCHD3 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to CHCHD3(coiled-coil-helix-coiled-coil-helix domain containing 3) The peptide sequence was selected from the middle region of CHCHD3.Peptide sequence LRERICSEEERAKAKHLARQLEEKDRVLKKQDAFYKEQLARLEERSSEFY.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
CHCHD3
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
- Western Blot 1:100-1:2000
|
| Application Notes |
This is a rabbit polyclonal antibody against CHCHD3 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for CHCHD3 Antibody
Background
The function of this protein remains unknown.
PMID: 20101193