CNOT6 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to CNOT6(CCR4-NOT transcription complex, subunit 6) The peptide sequence was selected from the N terminal of CNOT6.Peptide sequence EISGKVRSLSASLWSLTHLTALHLSDNSLSRIPSDIAKLHNLVYLDLSSN.
|
| Specificity |
This product is specific to Subunit or Isofrom: 6.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
CNOT6
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against CNOT6 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS & 2% Sucrose.
|
| Preservative |
No Preservative
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for CNOT6 Antibody
- carbon catabolite repression 4 protein
- Carbon catabolite repressor protein 4 homolog
- CCR4 carbon catabolite repression 4-like
- CCR4CCR4-NOT transcription complex subunit 6
- CCR4-NOT transcription complex, subunit 6
- Cytoplasmic deadenylase
- EC 3.1.13.4
- KIAA1194EC 3.1
Background
CNOT6 is a subunit of the CCR4-NOT core transcriptional regulation complex. CNOT6 has a 3-5 RNase activity and prefers polyadenylated substates.The protein encoded by this gene is a subunit of the CCR4-NOT core transcriptional regulation complex. The encoded protein has a 3-5 RNase activity and prefers polyadenylated substates.