Product: RGB-286638 (free base)
COQ2 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to COQ2(coenzyme Q2 homolog, prenyltransferase (yeast)) The peptide sequence was selected from the middle region of COQ2.Peptide sequence FSGVMWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWLSGFSVAML.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
COQ2
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against COQ2 and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Theoretical MW |
42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for COQ2 Antibody
- 4-hydroxybenzoate polyprenyltransferase
- coenzyme Q2 homolog, prenyltransferase (yeast)
- COQ2 homolog
- EC 2.5.1
- EC 2.5.1.39
- FLJ13014
- hCOQ2
- mitochondrial
- Para-hydroxybenzoate–polyprenyltransferase
- para-hydroxybenzoate-polyprenyltransferase, mitochondrial
- PHB:polyprenyltransferase
Background
COQ2 catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. COQ2 mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis, which is the condensation of the polyisoprenoid side chain with PHB.CoQ (ubiquinone) serves as a redox carrier in the mitochondrial respiratory chain and is a lipid-soluble antioxidant. COQ2, or parahydroxybenzoate-polyprenyltransferase (EC 2.5.1.39), catalyzes one of the final reactions in the biosynthesis of CoQ, the prenylation of parahydroxybenzoate with an all-trans polyprenyl group (Forsgren et al., 2004 [PubMed 15153069]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-90 BC020728.1 1-90 91-96 BG699931.1 80-85 97-789 BC020728.1 97-789 790-792 BQ363759.1 169-171 793-1535 BC020728.1 793-1535 1536-1554 BC008804.2 1496-1514