Product: Mepenzolate (Bromide)
CPEB2 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to CPEB2 (cytoplasmic polyadenylation element binding protein 2) The peptide sequence was selected from the N terminal of CPEB2. Peptide sequence FLQQRNSYNHHQPLLKQSPWSNHQSSGWGTGSMSWGAMHGRDHRRTGNMG.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
CPEB2
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against CPEB2 and was validated on Western blot.
In Simple Western only 10 – 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
| Theoretical MW |
65 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS & 2% Sucrose.
|
| Preservative |
No Preservative
|
| Concentration |
LYOPH
|
| Purity |
Immunogen affinity purified
|
| Reconstitution Instructions |
Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for CPEB2 Antibody
- CPEB-2
- CPE-binding protein 2
- CPE-BP2
- cytoplasmic polyadenylation element binding protein 2
- cytoplasmic polyadenylation element-binding protein 2
- hCPEB-2
- MGC119575
- MGC119576
- MGC119577
Background
CPEB2 is highly similar to cytoplasmic polyadenylation element binding protein (CPEB), an mRNA-binding protein that regulates cytoplasmic polyadenylation of mRNA as a trans factor in oogenesis and spermatogenesis. Studies of the similar gene in mice suggested a possible role of this protein in transcriptionally inactive haploid spermatids.The protein encoded by this gene is highly similar to cytoplasmic polyadenylation element binding protein (CPEB), an mRNA-binding protein that regulates cytoplasmic polyadenylation of mRNA as a trans factor in oogenesis and spermatogenesis. Studies of the similar gene in mice suggested a possible role of this protein in transcriptionally inactive haploid spermatids. Alternatively spliced transcript variants encoding distinct isoforms have been described.