CYP11B1 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to CYP11B1 (cytochrome P450, family 11, subfamily B, polypeptide 1) The peptide sequence was selected from the middle region of CYP11B1.Peptide sequence LALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPK.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
CYP11B1
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against CYP11B1 and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Theoretical MW |
55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for CYP11B1 Antibody
- CPN1
- CYPXIB1
- cytochrome P450 11B1, mitochondrial
- cytochrome p450 XIB1
- cytochrome P450, family 11, subfamily B, polypeptide 1
- cytochrome P450, subfamily XIB (steroid 11-beta-hydroxylase), polypeptide 1
- Cytochrome P450C11
- Cytochrome P-450c11
- EC 1.14.15
- EC 1.14.15.4
- FHICYP11B
- FLJ36771
- P450C11DKFZp686B05283
- S11BH
- Steroid 11-beta-hydroxylase
- steroid 11-beta-monooxygenase
Background
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane and is involved in the conversion of progesterone to cortisol in the adrenal cortex. Mutations in this gene cause congenital adrenal hyperplasia due to 11-beta-hydroxylase deficiency. Transcript variants encoding different isoforms have been noted for this gene.