Chitobiase/CTBS Antibody (1B5-1B9) Summary
| Immunogen |
CTBS (AAH24007.2, 37 a.a. – 105 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DCPCPEPELCRPIRHHPDFEVFVFDVGQKTWKSYDWSQITTVATFGKYDSELMCYAHSKGARVVLKGNL
|
| Specificity |
CTBS – chitobiase, di-N-acetyl-
|
| Isotype |
IgG1 Kappa
|
| Clonality |
Monoclonal
|
| Host |
Mouse
|
| Gene |
CTBS
|
| Purity |
IgG purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactivity against cell lysate for WB. It has been used for ELISA.
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.4)
|
| Preservative |
No Preservative
|
| Purity |
IgG purified
|
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Chitobiase/CTBS Antibody (1B5-1B9)
- Chitobiase
- chitobiase, di-N-acetyl-
- CTBdi-N-acetylchitobiase
- CTBS
- EC 3.2.1.-