Product: CBB1003 (hydrochloride)
Cytokeratin 3 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to KRT3 (keratin 3) The peptide sequence was selected from the C terminal of KRT3. Peptide sequence GSSGFSGGSGFGSISGARYGVSGGGFSSASNRGGSIKFSQSSQSSQRYSR.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
KRT3
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against KRT3 and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Theoretical MW |
64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Cytokeratin 3 Antibody
- CK3
- CK-3
- cytokeratin-3
- FLJ95909
- K3cytokeratin 3
- keratin 3
- keratin, type II cytoskeletal 3,65 kDa cytokeratin
- Keratin-3
- Type-II keratin Kb3
Background
The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the corneal epithelium with family member KRT12 and mutations in these genes have been associated with Meesmanns Corneal Dystrophy. The type II cytokeratins are clustered in a region of chromosome 12q12-q13.