Dectin-2/CLEC6A Antibody Summary
| Immunogen |
Synthetic peptides corresponding to CLEC6A(C-type lectin domain family 6, member A) Antibody(against the N terminal of CLEC6A (NP_001007034).Peptide sequence FIVSCVVTYHFTYGETGKRLSELHSYHSSLTCFSEGTKVPAWGCCPASWK.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
CLEC6A
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
| Theoretical MW |
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Dectin-2/CLEC6A Antibody
- CLEC4N
- CLEC6A
- CLECSF10
- C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamilymember 10
- C-type lectin domain family 6 member A
- C-type lectin domain family 6, member A
- C-type lectin superfamily member 10
- DC-associated C-type lectin 2
- dectin 2
- Dectin2
- Dectin-2
- Dendritic cell-associated C-type lectin 2
Background
CLEC6A may be involved in regulating immune reactivity.