Product: Diclofensine (hydrochloride)
Dishevelled-1 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to DVL1(dishevelled, dsh homolog 1 (Drosophila)) The peptide sequence was selected from the middle region of DVL1. Peptide sequence LKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNK.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
DVL1
|
| Purity |
Protein A purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
|
| Application Notes |
A band is observed at ~38kDa by Western Blot. Use in Immunohistochemistry-Paraffin reported in scientific literature (PMID 25975243)
|
|
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Protein A purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Dishevelled-1 Antibody
- dishevelled 1 (homologous to Drosophila dsh)
- dishevelled, dsh homolog 1 (Drosophila)
- Dishevelled1
- Dishevelled-1
- DSH homolog 1
- Dsh
- DVL
- DVL1
- DVL1L1
- MGC54245
- segment polarity protein dishevelled homolog DVL-1
Background
DVL1 is a cytoplasmic phosphoprotein that regulates cell proliferation, acting as a transducer molecule for developmental processes, including segmentation and neuroblast specification. DVL1 gene is a candidate for neuroblastomatous transformation. The Schwartz-Jampel syndrome and Charcot-Marie-Tooth disease type 2A have been mapped to the same region as DVL1 gene. The phenotypes of these diseases may be consistent with defects which might be expected from aberrant expression of a DVL gene during development.