Product: Rhosin (hydrochloride)
GABA Receptor Epsilon Antibody Summary
| Immunogen |
Synthetic peptide directed towards the N terminal of human GABRE. Peptide sequence DVVYGPQPQPLENQLLSEETKSTETETGSRVGKLPEASRILNTILSNYDH.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
GABRE
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against GABRE and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS & 2% Sucrose.
|
| Preservative |
No Preservative
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for GABA Receptor Epsilon Antibody
- GABA A R epsilon
- GABA(A) receptor subunit epsilon
- GABAAR epsilon
- GABAARe
- gamma-aminobutyric acid (GABA) A receptor, epsilon
- gamma-aminobutyric acid receptor subunit epsilon