Product: Remodelin (hydrobromide)
HACE1 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to HACE1(HECT domain and ankyrin repeat containing, E3 ubiquitin protein ligase 1) The peptide sequence was selected from the middle region of HACE1.Peptide sequence DVSDWIKNTEYTSGYEREDPVIQWFWEVVEDITQEERVL
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
HACE1
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against HACE1 and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Theoretical MW |
102 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS & 2% Sucrose.
|
| Preservative |
No Preservative
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for HACE1 Antibody
- E3 ubiquitin-protein ligase HACE1
- EC 6.3.2
- HACE
- HECT domain and ankyrin repeat containing, E3 ubiquitin protein ligase 1
- HECT domain and ankyrin repeat-containing E3 ubiquitin-protein ligase 1
- KIAA1320EC 6.3.2.-
Background
HACE1 contains 6 ANK repeats and 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain. HACE1 is an E3 ubiquitin-protein ligase that may function in cellular proteins degradation.