HADHB Antibody Summary
| Immunogen |
Synthetic peptides corresponding to HADHB(hydroxyacyl-Coenzyme A dehydrogenase (trifunctional protein), beta subunit) The peptide sequence was selected from the C terminal of HADHB.Peptide sequence LLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANF
|
| Specificity |
This product is specific to Subunit or Isofrom: beta, mitochondrial.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
HADHB
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against HADHB and was validated on Western Blot and immunohistochemistry-P
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Theoretical MW |
47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for HADHB Antibody
- 2-enoyl-Coenzyme A (CoA) hydratase, beta subunit
- 3-ketoacyl-Coenzyme A (CoA) thiolase of mitochondrial trifunctional protein
- acetyl-CoA acyltransferase
- beta subunit
- beta-ketothiolase
- EC 2.3.1
- EC 2.3.1.16
- ECHB
- hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase(trifunctional protein), beta subunit
- hydroxyacyl-Coenzyme A (CoA) dehydrogenase, beta subunit
- hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme Athiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit
- MGC87480
- mitochondrial trifunctional enzyme, beta subunit
- mitochondrial trifunctional protein, beta subunit
- MTPB
- TP-beta
- trifunctional enzyme subunit beta, mitochondrial
Background
HADHB is the beta subunit of the mitochondrial trifunctional protein, which catalyzes the last three steps of mitochondrial beta-oxidation of long chain fatty acids. The mitochondrial membrane-bound heterocomplex is composed of four alpha and four beta subunits, with the beta subunit catalyzing the 3-ketoacyl-CoA thiolase activity. Mutations in HADHB gene result in trifunctional protein deficiency. The protein can also bind RNA and decreases the stability of some mRNAs.This gene encodes the beta subunit of the mitochondrial trifunctional protein, which catalyzes the last three steps of mitochondrial beta-oxidation of long chain fatty acids. The mitochondrial membrane-bound heterocomplex is composed of four alpha and four beta subunits, with the beta subunit catalyzing the 3-ketoacyl-CoA thiolase activity. Mutations in this gene result in trifunctional protein deficiency. The encoded protein can also bind RNA and decreases the stability of some mRNAs. The genes of the alpha and beta subunits of the mitochondrial trifunctional protein are located adjacent to each other in the human genome in a head-to-head orientation. Alternatively spliced transcript variants have been found; however, their full-length nature is not known. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.