HAO2 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to HAO2(hydroxyacid oxidase 2 (long chain)) The peptide sequence was selected from the N terminal of HAO2.Peptide sequence DDNIAAFKRIRLRPRYLRDVSEVDTRTTIQGEEISAPICIAPTGFHCLVW.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
HAO2
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against HAO2 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS & 2% Sucrose.
|
| Preservative |
No Preservative
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for HAO2 Antibody
- (S)-2-hydroxy-acid oxidase, peroxisomal
- Cell growth-inhibiting gene 16 protein
- EC 1.1.3.15
- GIG16
- growth-inhibiting protein 16
- HAOX2glycolate oxidase
- hydroxyacid oxidase 2 (long chain)
- hydroxyacid oxidase 2
- Long chain alpha-hydroxy acid oxidase
- Long-chain L-2-hydroxy acid oxidase
Background
HAO2 is one of three related proteins that have 2-hydroxyacid oxidase activity yet differ in amino acid sequence, tissue expression and substrate preference. Subcellular location of the protein is the peroxisome. Specifically, the protein is expressed predominantly in liver and kidney and has the highest activity toward the substrate 2-hydroxypalmitate. Two alternatively spliced variants encoding the same isoform have been described.This gene is one of three related genes that have 2-hydroxyacid oxidase activity yet differ in encoded protein amino acid sequence, tissue expression and substrate preference. Subcellular location of the encoded protein is the peroxisome. Specifically, this gene is expressed predominantly in liver and kidney and has the highest activity toward the substrate 2-hydroxypalmitate. Two alternatively spliced variants encoding the same isoform have been described.