HDLBP Antibody Summary
| Immunogen |
Synthetic peptides corresponding to HDLBP1/GPIHBP1 (high density lipoprotein binding protein (vigilin)) The peptide sequence was selected from the N terminal of HDLBP1/GPIHBP1.Peptide sequence MSSVAVLTQESFAEHRSGLVPQQIKVATLNSEEESDPPTYKDAFPPLPEK.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
HDLBP
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against HDLBP and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS & 2% Sucrose.
|
| Preservative |
No Preservative
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for HDLBP Antibody
- HBPFLJ16432
- HDL-binding protein
- high density lipoprotein binding protein
- High density lipoprotein-binding protein
- PRO2900
- VGLvigilin
Background
HDLBP is high density lipoprotein-binding protein, also known as vigilin, is a 110-kD protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.High density lipoprotein-binding protein, also known as vigilin, is a 110-kD protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.High density lipoprotein-binding protein, also known as vigilin, is a 110-kD protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.[supplied by OMIM].