HLA F Antibody Summary
| Immunogen |
Synthetic peptides corresponding to HLA-F (major histocompatibility complex, class I, F) The peptide sequence was selected from the N terminal of HLA-F.Peptide sequence PWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMN.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
HLA-F
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against HLA-F and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for HLA F Antibody
- alpha chain F
- HLA class I molecule
- HLA F antigen
- HLA-5.4
- HLAFHLA-CDA12
- Leukocyte antigen F
- major histocompatibility complex, class I, F
- MHC class I antigen F
- MHC class Ib antigen
Background
HLA-F belongs to the HLA class I heavy chain paralogues. It is a non-classical heavy chain that forms a heterodimer with a beta-2 microglobulin light chain, with the heavy chain anchored in the membrane. Unlike most other HLA heavy chains, this molecule is localized in the endoplasmic reticulum and Golgi apparatus, with a small amount present at the cell surface in some cell types. It contains a divergent peptide-binding groove, and is thought to bind a restricted subset of peptides for immune presentation.