Heparan Sulfate Glucosamine 3-O-Sulfotransferase 3 Antibody Summary
| Immunogen |
Synthetic peptide directed towards the N terminal of human HS3ST3B1. Peptide sequence AMLCVWLYMFLYSCAGSCAAAPGLLLLGSGSRAAHDPPALATAPDGTPPR.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
HS3ST3B1
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against HS3ST3B1 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Heparan Sulfate Glucosamine 3-O-Sulfotransferase 3 Antibody
- 3OST3B1
- h3-OST-3B
- heparan sulfate (glucosamine) 3-O-sulfotransferase 3B1
- Heparan Sulfate Glucosamine 3OSulfotransferase 3
- HS3ST3B1