Hydroxyacid Oxidase-1/HAO-1 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to HAO1(hydroxyacid oxidase (glycolate oxidase) 1) The peptide sequence was selected from the C terminal of HAO1. Peptide sequence GLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
HAO1
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against HAO1 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
| Theoretical MW |
41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS & 2% Sucrose.
|
| Preservative |
No Preservative
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Hydroxyacid Oxidase-1/HAO-1 Antibody
- (S)-2-hydroxy-acid oxidase
- EC 1.1.3.15
- Glycolate oxidase
- GOX
- GOX1MGC142227
- GOXMGC142225
- HAO1
- HAO-1
- HAOX1
- hydroxyacid oxidase (glycolate oxidase) 1
- hydroxyacid oxidase 1
- Hydroxyacid Oxidase1
- Hydroxyacid Oxidase-1
Background
Subcellular location of HAO1 is the peroxisome. Specifically, HAO1 is expressed primarily in liver and pancreas and is most active on glycolate, a two-carbon substrate. The protein is also active on 2-hydroxy fatty acids.This gene is one of three related genes that have 2-hydroxyacid oxidase activity yet differ in encoded protein amino acid sequence, tissue expression and substrate preference. Subcellular location of the encoded protein is the peroxisome. Specifically, this gene is expressed primarily in liver and pancreas and the encoded protein is most active on glycolate, a two-carbon substrate. The protein is also active on 2-hydroxy fatty acids. The transcript detected at high levels in pancreas may represent an alternatively spliced form or the use of a multiple near-consensus upstream polyadenylation site.