IFIT5 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to IFIT5(interferon-induced protein with tetratricopeptide repeats 5) The peptide sequence was selected from the middle region of IFIT5.Peptide sequence ITVYRLDDSDREGSVKSFSLGPLRKAVTLNPDNSYIKVFLALKLQDVHAE.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
IFIT5
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against IFIT5 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for IFIT5 Antibody
- FLJ53857
- IFIT-5
- interferon-induced protein with tetratricopeptide repeats 5
- Retinoic acid- and interferon-inducible 58 kDa protein
- retinoic acid- and interferon-inducible protein (58kD)
- RI58FLJ92678
Background
IFIT5 belongs to the IFIT family. It contains 8 TPR repeats. The exact function of IFIT5 remains unknown.