Integrin beta-like protein 1 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to ITGBL1(integrin, beta-like 1 (with EGF-like repeat domains)) The peptide sequence was selected from the N terminal of ITGBL1.Peptide sequence MRPPGFRNFLLLASSLLFAGLSAVPQSFSPSLRSWPGAACRLSRAESERR.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
ITGBL1
|
| Purity |
Protein A purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against ITGBL1 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Protein A purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Integrin beta-like protein 1 Antibody
- integrin, beta-like 1 (with EGF-like repeat domains)
- OSCPITGBL1, integrin beta-like 1
- Osteoblast-specific cysteine-rich protein
- Ten integrin EGF-like repeat domain-containing protein
- ten integrin EGF-like repeat domains protein
- TIEDintegrin beta-like protein 1
Background
The function remains unknown.