Kirrel2/NEPH3 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to KIRREL2(kin of IRRE like 2 (Drosophila)) The peptide sequence was selected from the N terminal of KIRREL2. Peptide sequence WSRYWISGNAANGQHDLHIRPVELEDEASYECQATQAGLRSRPAQLHVLV.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
KIRREL2
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against KIRREL2 and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Theoretical MW |
67 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Kirrel2/NEPH3 Antibody
- DKFZp564A1164
- Filtrin
- FILTRINkin of IRRE-like protein 2
- kin of IRRE like 2 (Drosophila)
- Kin of irregular chiasm-like protein 2
- Kirrel2
- MGC15718
- NEPH3
- NEPH3Nephrin-like protein 3
- nephrin-like 3
- nephrin-like gene 1
- NLG1
- NLG1kin of irregular chiasm-like 2
Background
KIRREL2 is a single-pass type I membrane protein. KIRREL2 protein is a beta-cell-expressed Ig domain protein and may be involved in pancreas development or beta cell function.