LMF2 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to LMF2(lipase maturation factor 2) The peptide sequence was selected from the middle region of LMF2.Peptide sequence YVEPGTHGRLWTGAHRLFGAVEHLQLANSYGLFRRMTGLGGRPEVVLEGS.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
LMF2
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against LMF2 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for LMF2 Antibody
- lipase maturation factor 2
- TMEM153
- Transmembrane protein 112BTransmembrane protein 153TMEM112B
Background
LMF2 belongs to the lipase maturation factor family. LMF2 is involved in the maturation of specific proteins in the endoplasmic reticulum. It may be required for maturation and transport of active lipoprotein lipase (LPL) through the secretory pathway.