MED31 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to MED31(mediator complex subunit 31) The peptide sequence was selected from the N terminal of MED31.Peptide sequence MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVN.
|
| Specificity |
This product is specific to Subunit or Isofrom: 31.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
MED31
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against MED31 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for MED31 Antibody
- CGI-125
- FLJ27436
- FLJ36714
- hSOH1
- mediator complex subunit 313110004H13Rik
- Mediator complex subunit SOH1
- mediator of RNA polymerase II transcription subunit 31
- mediator of RNA polymerase II transcription, subunit 31 homolog (S. cerevisiae)
- mediator of RNA polymerase II transcription, subunit 31 homolog
- Soh1
Background
MED31 is the component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal