Product: SAR407899 (hydrochloride)
MED7 Antibody Summary
| Immunogen |
The immunogen for this antibody is MED7 – C-terminal region. Peptide sequence LASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIE.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
MED7
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
| Theoretical MW |
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS & 2% Sucrose.
|
| Preservative |
No Preservative
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for MED7 Antibody
- Activator-recruited cofactor 34 kDa component
- Cofactor required for Sp1 transcriptional activation subunit 9
- cofactor required for Sp1 transcriptional activation, subunit 9 (33kD)
- cofactor required for Sp1 transcriptional activation, subunit 9, 33kDa
- CRSP33CRSP complex subunit 9
- CRSP9hMED7
- mediator complex subunit 7ARC34
- mediator of RNA polymerase II transcription subunit 7
- MGC12284
- RNA polymerase transcriptional regulation mediator subunit 7 homolog
- Transcriptional coactivator CRSP33
Background
The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. Two transcript variants encoding the same protein have been found for this gene.