Product: Z-Ile-Glu-Pro-Phe-Ome
MFRP Antibody Summary
| Immunogen |
Synthetic peptides corresponding to MFRP(membrane frizzled-related protein) The peptide sequence was selected from the middle region of MFRP.Peptide sequence HAIQLKIEALSIESVASCLFDRLELSPEPEGPLLRVCGRVPPPTLNTNAS.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
MFRP
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against MFRP and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS & 2% Sucrose.
|
| Preservative |
No Preservative
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for MFRP Antibody
- MCOP5
- membrane frizzled-related protein
- Membrane-type frizzled-related protein
- MFRP
- MGC32938
- NNO2
- rd6
Background
MFRP is a member of the frizzled-related proteins. It may play a role in eye development, as mutations in this gene have been associated with nanophthalmos, posterior microphthalmia, retinitis pigmentosa, foveoschisis, and optic disc drusen. The protein is encoded by a bicistronic mRNA, which also encodes C1q and tumor necrosis factor related protein 5.