Product: 4-Methylbenzylidene camphor
MOS Antibody Summary
| Immunogen |
Synthetic peptides corresponding to MOS(v-mos Moloney murine sarcoma viral oncogene homolog) The peptide sequence was selected from the middle region of MOS. Peptide sequence LNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAG.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
MOS
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
|
| Application Notes |
This is a rabbit polyclonal antibody against MOS and was validated on Western blot.
|
|
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for MOS Antibody
- c-mos
- EC 2.7.11
- EC 2.7.11.1
- MGC119962
- MGC119963
- MSV
- oncogene MOS, Moloney murine sarcoma virus
- Oocyte maturation factor mos
- Proto-oncogene c-Mos
- proto-oncogene serine/threonine-protein kinase mos
- v-mos Moloney murine sarcoma viral oncogene homolog
Background
MOS is a serine/threonine kinase that activates the MAP kinase cascade through direct phosphorylation of the MAP kinase activator MEK (MAP2K1; MIM 176872) (Prasad et al., 2008 [PubMed 18246541]).