MTCH1 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to MTCH1(mitochondrial carrier homolog 1 (C. elegans)) The peptide sequence was selected from the C terminal of MTCH1.Peptide sequence NNCGLQAGLPPYSPVFKSWIHCWKYLSVQGQLFRGSSLLFRRVSSGSCFA.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
MTCH1
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against MTCH1 and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Theoretical MW |
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for MTCH1 Antibody
- cell proliferation-inducing protein 60
- CGI-64
- MGC131998
- mitochondrial carrier homolog 1 (C. elegans)
- mitochondrial carrier homolog 1
- Presenilin-associated protein
- PSAPPIG60
Background
MTCH1 is a potential mitochondrial transporter. It may play a role in apoptosis.