Product: SCH-1473759 (hydrochloride)
Mkl1 Antibody Summary
| Immunogen |
Synthetic peptide directed towards the C terminal of human MKL1. Peptide sequence QPLSQPGFPAPGPPAQMDLEHPPQPPFATPTSLLKKEPPGYEETVTQQPK.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
MKL1
|
| Purity |
Protein A purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against MKL1 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Protein A purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Mkl1 Antibody
- AMKL
- KIAA1438
- MALSAP and coiled-coil domain
- megakaryoblastic leukemia (translocation) 1
- Megakaryoblastic leukemia 1 protein
- Megakaryocytic acute leukemia protein
- MKL/myocardin-like protein 1
- Myocardin-related transcription factor A
- RNA-binding motif protein 15/megakaryoblastic leukemia-1 fusion protein