Product: Debutyldronedarone D7
NAT2 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to NAT2 (N-acetyltransferase 2 (arylamine N-acetyltransferase)) The peptide sequence was selected from the middle region of NAT2)(50ug).Peptide sequence TYRKFNYKDNTDLVEFKTLTEEEVEEVLRNIFKISLGRNLVPKPGDGSLT.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
NAT2
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against NAT2 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for NAT2 Antibody
- AAC2N-acetyltransferase type 2
- Arylamide acetylase 2
- arylamine N-acetyltransferase 2
- EC 2.3.1.5
- N-acetyltransferase 2 (arylamine N-acetyltransferase)
- NAT-2
- PNAT
- Polymorphic arylamine N-acetyltransferase
Background
NAT2 is a N-acetyltransferase 2 (arylamine N-acetyltransferase 2). This enzyme functions to both activate and deactivate arylamine and hydrazine drugs and carcinogens. Polymorphisms in its gene are reponsible for the N-acetylation polymorphism in which human populations segregate into rapid,intermediate, and slow acetylator phenotypes. Polymorphisms in NAT2 are also associated with higher incidences of cancer and drug toxicity.