NDUFV1 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to NDUFV1(NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa) The peptide sequence was selected from the N terminal of NDUFV1.Peptide sequence FMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMG.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
NDUFV1
|
| Purity |
Protein A purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against NDUFV1 and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Theoretical MW |
51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Protein A purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for NDUFV1 Antibody
- CI-51K
- CI51KD
- CI-51kD
- complex I 51kDa subunit
- complex I, mitochondrial respiratory chain
- Complex I-51kD
- EC 1.6.5.3
- EC 1.6.99.3
- EC 1.6.99.5
- FLJ59059
- mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1
- NADH dehydrogenase (ubiquinone) flavoprotein 1 (51kD)
- NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa
- NADH dehydrogenase flavoprotein 1
- NADH-ubiquinone oxidoreductase 51 kDa subunit
- UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
Background
NDUFV1 is the 51-kD subunit of complex I (NADH:ubiquinone oxidoreductase) of the mitochondrial respiratory chain.The NDUFV1 gene encodes the 51-kD subunit of complex I (NADH:ubiquinone oxidoreductase) of the mitochondrial respiratory chain.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.