NECAB3 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to NECAB3 (N-terminal EF-hand calcium binding protein 3) The peptide sequence was selected from the middle region of NECAB3)(50ug).Peptide sequence ESVEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWRLQV.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
NECAB3
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against NECAB3 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for NECAB3 Antibody
- Amyloid beta A4 protein-binding family A member 2-binding protein
- APBA2BPfamily A, member 2 binding protein
- dJ63M2.4
- dJ63M2.5
- EFCBP3STIP3
- EF-hand calcium binding protein 3
- Neuronal calcium-binding protein 3
- neuronal calcium-binding protein NECAB3
- NIP1Nek2-interacting protein 1
- N-terminal EF-hand calcium binding protein 3
- N-terminal EF-hand calcium-binding protein 3
- synaptotagmin interacting protein 2
- synaptotagmin interacting protein STIP3
- SYTIP2
- XB51X11L-binding protein 51
Background
The protein encoded by this gene interacts with the amino-terminal domain of the neuron-specific X11-like protein (X11L), inhibits the association of X11L with amyloid precursor protein through a non-competitive mechanism, and abolishes the suppression of beta-amyloid production by X11L. This protein, together with X11L, may play an important role in the regulatory system of amyloid precursor protein metabolism and beta-amyloid generation. The protein is phosphorylated by NIMA-related expressed kinase 2, and localizes to the Golgi apparatus. Multiple transcript variants encoding different isoforms have been found for this gene.