NSUN2 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to NSUN2(NOL1/NOP2/Sun domain family, member 2) The peptide sequence was selected from the C terminal of NSUN2.Peptide sequence FINSRIITVSMEDVKILLTQENPFFRKLSSETYSQAKDLAKGSIVLKYEP.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
NSUN2
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against NSUN2 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for NSUN2 Antibody
- EC 2.1.1
- EC 2.1.1.29
- FLJ20303,5-methycytoisine methyltransferase
- hTrm4
- member 2
- Myc-induced SUN-domain-containing protein
- NOL1/NOP2/Sun domain family 2
- NOL1/NOP2/Sun domain family member 2
- NOP2/Sun domain family, member 2
- SAKIMisu
- Substrate of AIM1/Aurora kinase B
- TRM4MISU
- tRNA (cytosine-5-)-methyltransferase NSUN2
- tRNA (cytosine-5-)-methyltransferase
- tRNA methyltransferase 4 homolog
Background
Maturation of cytoplasmic tRNAs includes splicing of introns, which are located 1 nucleotide 3-prime from the anticodon in all intron-containing tRNA genes. In tRNA-leu(CAA), the first position of the anticodon, C34, is converted to 5-methylcytosine, a modification necessary to stabilize the anticodon-codon pairing and correctly translate the mRNA. NSUN2 is a methyltransferase that catalyzes the intron-dependent formation of 5-methylcytosine at C34 of tRNA-leu(CAA).Maturation of cytoplasmic tRNAs includes splicing of introns, which are located 1 nucleotide 3-prime from the anticodon in all intron-containing tRNA genes. In tRNA-leu(CAA), the first position of the anticodon, C34, is converted to 5-methylcytosine, a modification necessary to stabilize the anticodon-codon pairing and correctly translate the mRNA. NSUN2 encodes a methyltransferase that catalyzes the intron-dependent formation of 5-methylcytosine at C34 of tRNA-leu(CAA) (Brzezicha et al., 2006 [PubMed 17071714]).[supplied by OMIM].