Neurotensin Receptor 1 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to NTSR1(neurotensin receptor 1 (high affinity)) The peptide sequence was selected from the N terminal of NTSR1.Peptide sequence FGNASGNASERVLAAPSSELDVNTDIYSKVLVTAVYLALFVVGTVGNTVT.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
NTSR1
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against NTSR1 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS & 2% Sucrose.
|
| Preservative |
No Preservative
|
| Concentration |
LYOPH
|
| Purity |
Immunogen affinity purified
|
| Reconstitution Instructions |
Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Neurotensin Receptor 1 Antibody
- High-affinity levocabastine-insensitive neurotensin receptor
- neurotensin receptor 1 (high affinity)
- neurotensin receptor type 1
- NTR
- NTR1
- NT-R-1
- NTRH
- NTRR
Background
Neurotensin receptor 1 belongs to the large superfamily of G-protein coupled receptors. NTSR1 mediates the multiple functions of neurotensin, such as hypotension, hyperglycemia, hypothermia, antinociception, and regulation of intestinal motility and secre