OBP2A Antibody Summary
| Immunogen |
The immunogen for this antibody is OBP2A – middle region. Peptide sequence NLEATFTFMREDRCIQKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDY.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
OBP2A
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
| Theoretical MW |
18 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for OBP2A Antibody
- hOBPIIa
- OBP
- OBP2C
- OBPIIa
- odorant binding protein 2A
- odorant-binding protein 2a
- Odorant-binding protein IIa
- putative odorant-binding protein 2c
Background
This gene encodes a small extracellular protein belonging to the lipocalin superfamily. The protein is thought to transport small, hydrophobic, volatile molecules or odorants through the nasal mucus to olfactory receptors, and may also function as a scavenger of highly concentrated or toxic odors. The protein is expressed as a monomer in the nasal mucus, and can bind diverse types of odorants with a higher affinity for aldehydes and fatty acids. This gene and a highly similar family member are located in a cluster of lipocalin genes on chromosome 9. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.